🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

HIF3A

DescriptionHypoxia-inducible factor 3-alpha

Gene and Protein Information

Gene ID64344
Uniprot Accession IDs Q9Y2N7 B0M185 B4DNA2 I6L988 Q58A43 Q66K72 Q8WXA1 Q96K34 Q9H7Z9 Q9HAI2 HIF-3-alpha
Ensembl ID ENSP00000366898
Symbol BHLHE17 MOP7 PASD7 IPAS MOP7 PASD7 HIF-3A bHLHe17 HIF3-alpha-1
Sequence
MALGLQRARSTTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLTISYLRMHRLCAAGEWNQVGAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLSQLELIGHSIFDFIHPCDQEELQDALTPQQTLSRRKVEAPTERCFSLRMKSTLTSRGRTLNLKAATWKVLNCSGHMRAYKPPAQTSPAGSPDSEPPLQCLVLICEAIPHPGSLEPPLGRGAFLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSKGQAVTGQYRFLARSGGYLWTQTQATVVSGGRGPQSESIVCVHFLISQVEETGVVLSLEQTEQHSRRPIQRGAPSQKDTPNPGDSLDTPGPRILAFLHPPSLSEAALAADPRRFCSPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALDLEMLAPYISMDDDFQLNASEQLPRAYHRPLGAVPRPRARSFHGLSPPALEPSLLPRWGSDPRLSCSSPSRGDPSASSPMAGARKRTLAQSSEDEDEGVELLGVRPPKRSPSPEHENFLLFPLSLSFLLTGGPAPGSLQDPSTPLLNLNEPLGLGPSLLSPYSDEDTTQPGGPFQPRAGSAQAD
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp456149HIF3Ahypoxia inducible factor 3 subunit alpha9598VGNC:7686OMA, EggNOG
Macaque717188HIF3Ahypoxia inducible factor 3 alpha subunit9544Inparanoid, OMA
Mouse53417Hif3ahypoxia inducible factor 3, alpha subunit10090MGI:1859778Inparanoid, OMA, EggNOG
Rat64345Hif3ahypoxia inducible factor 3, alpha subunit10116RGD:70332Inparanoid, OMA, EggNOG
Horse100071095HIF3Ahypoxia inducible factor 3 subunit alpha9796VGNC:18784Inparanoid, OMA, EggNOG
Cow507699HIF3Ahypoxia inducible factor 3 subunit alpha9913VGNC:29850Inparanoid, OMA, EggNOG
Pig100621574HIF3Ahypoxia inducible factor 3 alpha subunit9823Inparanoid, OMA, EggNOG
Anole lizardHIF3Ahypoxia inducible factor 3 alpha subunit [Source:HGNC Symbol;Acc:HGNC:15825]28377Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    transcription factor    /    nucleic acid binding    /    Hypoxia-inducible factor 3-alpha
protein    /    transcription factor    /    basic helix-loop-helix transcription factor    /    Hypoxia-inducible factor 3-alpha
DTO Classes
protein    /    Transcription factor    /    Basic helix-loop-helix transcription factor    /    Hypoxia-inducible factor 3-alpha

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.