224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | HLA class I histocompatibility antigen, alpha chain F |
|---|
Gene and Protein Information
| Gene ID | 3134 |
|---|---|
| Uniprot Accession IDs | P30511 Q5JQI8 Q5JQJ1 Q5SPT5 Q860R0 Q8MGQ1 Q8WLP5 Q95HC0 Q9TP68 |
| Ensembl ID | ENSP00000259951 |
| Symbol | HLA-5.4 HLAF HLAF CDA12 HLA-5.4 HLA-CDA12 |
| Family | Belongs to the MHC class I family. |
| Sequence | MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGSYSQAAV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 709076 | MAMU-F | major histocompatibility complex, class I, F | 9544 | Inparanoid, OMA | |
| Mouse | 110557 | H2-Q6 | histocompatibility 2, Q region locus 6 | 10090 | MGI:95935 | Inparanoid, OMA |
| Rat | 309607 | RT1-CE5 | RT1 class I, locus CE5 | 10116 | RGD:1595868 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.