ID2

DescriptionDNA-binding protein inhibitor ID-2

Gene and Protein Information

Gene ID3398
Uniprot Accession IDs Q02363
Ensembl ID ENSP00000234091
Symbol BHLHB26 GIG8 ID2A ID2H bHLHb26
Sequence
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque693394ID2inhibitor of DNA binding 29544Inparanoid, OMA, EggNOG
Mouse15902Id2inhibitor of DNA binding 210090MGI:96397Inparanoid, OMA, EggNOG
Rat25587Id2inhibitor of DNA binding 210116RGD:2859Inparanoid, OMA, EggNOG
Horse100057240ID2inhibitor of DNA binding 29796VGNC:51321Inparanoid, OMA, EggNOG
Cow505025ID2inhibitor of DNA binding 29913Inparanoid, OMA, EggNOG
Pig654298ID2inhibitor of DNA binding 29823Inparanoid, OMA, EggNOG
Opossum100028188ID2inhibitor of DNA binding 213616Inparanoid, EggNOG
Platypus100084227ID2inhibitor of DNA binding 29258Inparanoid, OMA, EggNOG
Xenopus394480id2inhibitor of DNA binding 28364XB-GENE-481297Inparanoid, OMA, EggNOG
Zebrafish266599id2ainhibitor of DNA binding 2a7955ZDB-GENE-020910-1Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.