🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

IL6R

DescriptionInterleukin-6 receptor subunit alpha

Gene and Protein Information

Gene ID3570
Uniprot Accession IDs P08887 A8KAE8 B2R6V4 Q16202 Q53EQ7 Q5FWG2 Q5VZ23 IL-6 receptor subunit alpha
Ensembl ID ENSP00000357470
Symbol IL6Q gp80 CD126 IL6RA IL6RQ IL-6RA IL-6R-1
FamilyBelongs to the type I cytokine receptor family. Type 3 subfamily.
Sequence
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp469506IL6Rinterleukin 6 receptor9598VGNC:1271OMA, EggNOG
Macaque716690IL6Rinterleukin 6 receptor9544Inparanoid, OMA, EggNOG
Mouse16194Il6rainterleukin 6 receptor, alpha10090MGI:105304Inparanoid, OMA, EggNOG
Rat24499Il6rinterleukin 6 receptor10116RGD:2902Inparanoid, OMA, EggNOG
Dog612271IL6Rinterleukin 6 receptor9615VGNC:41993Inparanoid, OMA, EggNOG
Horse102148787IL6Rinterleukin 6 receptor9796VGNC:19035Inparanoid, OMA, EggNOG
Cow507359IL6Rinterleukin 6 receptor9913VGNC:30167Inparanoid, OMA, EggNOG
Pig399522IL6Rinterleukin 6 receptor9823Inparanoid, EggNOG
Opossum100020561IL6Rinterleukin 6 receptor13616OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    defense/immunity protein    /    Interleukin-6 receptor subunit alpha
protein    /    signaling molecule    /    cytokine    /    Interleukin-6 receptor subunit alpha
DTO Classes
protein    /    Signaling    /    Cytokine    /    Interleukin-6 receptor subunit alpha

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.