🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

IL21

DescriptionInterleukin-21

Gene and Protein Information

Gene ID59067
Uniprot Accession IDs Q9HBE4 A5J0L4 IL-21
Ensembl ID ENSP00000264497
Symbol Za11 IL-21 CVID11
FamilyBelongs to the IL-15/IL-21 family.
Sequence
MERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp471295IL21interleukin 219598VGNC:618OMA, EggNOG
Macaque708125IL21interleukin 219544Inparanoid, OMA, EggNOG
Mouse60505Il21interleukin 2110090MGI:1890474Inparanoid, OMA, EggNOG
Rat365769Il21interleukin 2110116RGD:1307384Inparanoid, OMA, EggNOG
Dog442935IL21interleukin 219615VGNC:41967Inparanoid, OMA, EggNOG
Horse100063803IL21interleukin 219796VGNC:19016Inparanoid, OMA, EggNOG
Cow378475IL21interleukin 219913VGNC:30141Inparanoid, OMA, EggNOG
Pig403123IL21interleukin 219823Inparanoid, OMA, EggNOG
Chicken554218IL21interleukin 219031CGNC:8978Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.