🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

IL25

DescriptionInterleukin-25

Gene and Protein Information

Gene ID64806
Uniprot Accession IDs Q9H293 Q2M3F0 Q8IZV3 Q8WXB0 IL-25
Ensembl ID ENSP00000328111
Symbol IL17E IL17E
FamilyBelongs to the IL-17 family.
Sequence
MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp467404IL25interleukin 259598VGNC:3404OMA, EggNOG
Macaque713943IL25interleukin 259544Inparanoid, OMA, EggNOG
Mouse140806Il25interleukin 2510090MGI:2155888Inparanoid, OMA, EggNOG
Rat501996Il25interleukin 2510116RGD:1561632Inparanoid, OMA, EggNOG
Dog480252IL25interleukin 259615VGNC:41975Inparanoid, OMA, EggNOG
Cow526816IL25interleukin 259913VGNC:30149Inparanoid, OMA, EggNOG
Pig100154041IL25interleukin 259823Inparanoid, OMA, EggNOG
OpossumIL25interleukin 25 [Source:HGNC Symbol;Acc:HGNC:13765]13616Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.