IFITM3

DescriptionInterferon-induced transmembrane protein 3

Gene and Protein Information

Gene ID10410
Uniprot Accession IDs Q01628 Q53Y76 Q96HK8 Q96J15
Ensembl ID ENSP00000382707
Symbol 1-8U IP15 DSPA2b
FamilyBelongs to the CD225/Dispanin family.
Sequence
MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp738726IFITM3interferon induced transmembrane protein 39598VGNC:1065Inparanoid, OMA, EggNOG
Macaque696527LOC696527interferon-induced transmembrane protein 39544OMA, EggNOG
Mouse80876Ifitm2interferon induced transmembrane protein 210090MGI:1933382OMA, EggNOG
Rat361673Ifitm3interferon induced transmembrane protein 310116RGD:1595844OMA, EggNOG
Dog475935LOC475935interferon-induced transmembrane protein 1-like9615OMA, EggNOG
Horse100050797LOC100050797interferon-induced transmembrane protein 1-like9796OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.