🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

DRD2

DescriptionD(2) dopamine receptor

Gene and Protein Information

Gene ID1813
Uniprot Accession IDs P14416 Q9NZR3 Q9UPA9
Ensembl ID ENSP00000354859
Symbol D2R D2DR
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp451553DRD2dopamine receptor D29598VGNC:3283Inparanoid, OMA, EggNOG
Macaque694181DRD2dopamine receptor D29544Inparanoid, OMA
Mouse13489Drd2dopamine receptor D210090MGI:94924Inparanoid, OMA, EggNOG
Rat24318Drd2dopamine receptor D210116RGD:2520Inparanoid, OMA
Dog403701DRD2dopamine receptor D29615VGNC:40094Inparanoid, OMA, EggNOG
Horse100062195DRD2dopamine receptor D29796VGNC:17315Inparanoid, OMA, EggNOG
Cow281126DRD2dopamine receptor D29913Inparanoid, OMA, EggNOG
Pig100624857DRD2dopamine receptor D29823Inparanoid, OMA, EggNOG
Opossum100026172DRD2dopamine receptor D213616Inparanoid, OMA, EggNOG
PlatypusDRD2dopamine receptor D2 [Source:HGNC Symbol;Acc:HGNC:3023]9258OMA, EggNOG
Chicken428252DRD2dopamine receptor D29031CGNC:5893Inparanoid, OMA, EggNOG
Anole lizard100557445drd2dopamine receptor D228377Inparanoid, OMA, EggNOG
Xenopusdrd2dopamine receptor D2 [Source:Xenbase;Acc:XB-GENE-1005779]8364OMA, EggNOG
Zebrafish282557drd2adopamine receptor D2a7955ZDB-GENE-021119-2Inparanoid, OMA
Zebrafish378719drd2bdopamine receptor D2b7955ZDB-GENE-030910-2OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    D(2) dopamine receptor
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Dopamine receptor    /    D(2) dopamine receptor

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.