🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

IGLC1

DescriptionImmunoglobulin lambda constant 1

Gene and Protein Information

Gene ID3537
Uniprot Accession IDs P0CG04 A0A075B6K8 A0M8Q4 P01842 P80423
Ensembl ID ENSP00000431254
Symbol IGLC
Sequence
GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.