FSHB

DescriptionFollitropin subunit beta

Gene and Protein Information

Gene ID2488
Uniprot Accession IDs P01225 A2TF08 A5JVV3 Q14D61
Ensembl ID ENSP00000416606
Symbol HH24
FamilyBelongs to the glycoprotein hormones subunit beta family.
Sequence
MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp736618FSHBfollicle stimulating hormone subunit beta9598VGNC:6558Inparanoid, OMA, EggNOG
Mouse14308Fshbfollicle stimulating hormone beta10090MGI:95582Inparanoid, OMA, EggNOG
Rat25447Fshbfollicle stimulating hormone subunit beta10116RGD:2630Inparanoid, OMA, EggNOG
Dog485428FSHBfollicle stimulating hormone subunit beta9615VGNC:40996Inparanoid, OMA, EggNOG
Horse100033829FSHBfollicle stimulating hormone beta subunit9796Inparanoid, OMA, EggNOG
Cow281171FSHBfollicle stimulating hormone beta subunit9913Inparanoid, OMA, EggNOG
Pig396895FSHBfollicle stimulating hormone beta subunit9823Inparanoid, OMA, EggNOG
Opossum554190FSHBfollicle stimulating hormone beta subunit13616Inparanoid, OMA, EggNOG
Platypus100073363FSHBfollicle stimulating hormone beta subunit9258Inparanoid, OMA, EggNOG
Chicken374108FSHBfollicle stimulating hormone beta subunit9031CGNC:9209OMA, EggNOG
Anole lizard100568157fshbfollicle stimulating hormone beta subunit28377Inparanoid, OMA, EggNOG
Xenopus100495812fshbfollicle stimulating hormone subunit beta8364XB-GENE-484695Inparanoid, OMA, EggNOG
Zebrafish402919fshbfollicle stimulating hormone subunit beta7955ZDB-GENE-040806-1OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    peptide hormone    /    Follitropin subunit beta
DTO Classes
protein    /    Signaling    /    Hormone    /    Follitropin subunit beta

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.