The store will not work correctly when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
FSHB Description Follitropin subunit beta
Gene and Protein Information Gene ID 2488 Uniprot Accession IDs P01225 A2TF08 A5JVV3 Q14D61 Ensembl ID ENSP00000416606 Symbol HH24 Family Belongs to the glycoprotein hormones subunit beta family. Sequence MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources Chimp 736618 FSHB follicle stimulating hormone subunit beta 9598 VGNC:6558 Inparanoid, OMA, EggNOG Mouse 14308 Fshb follicle stimulating hormone beta 10090 MGI:95582 Inparanoid, OMA, EggNOG Rat 25447 Fshb follicle stimulating hormone subunit beta 10116 RGD:2630 Inparanoid, OMA, EggNOG Dog 485428 FSHB follicle stimulating hormone subunit beta 9615 VGNC:40996 Inparanoid, OMA, EggNOG Horse 100033829 FSHB follicle stimulating hormone beta subunit 9796 Inparanoid, OMA, EggNOG Cow 281171 FSHB follicle stimulating hormone beta subunit 9913 Inparanoid, OMA, EggNOG Pig 396895 FSHB follicle stimulating hormone beta subunit 9823 Inparanoid, OMA, EggNOG Opossum 554190 FSHB follicle stimulating hormone beta subunit 13616 Inparanoid, OMA, EggNOG Platypus 100073363 FSHB follicle stimulating hormone beta subunit 9258 Inparanoid, OMA, EggNOG Chicken 374108 FSHB follicle stimulating hormone beta subunit 9031 CGNC:9209 OMA, EggNOG Anole lizard 100568157 fshb follicle stimulating hormone beta subunit 28377 Inparanoid, OMA, EggNOG Xenopus 100495812 fshb follicle stimulating hormone subunit beta 8364 XB-GENE-484695 Inparanoid, OMA, EggNOG Zebrafish 402919 fshb follicle stimulating hormone subunit beta 7955 ZDB-GENE-040806-1 OMA, EggNOG
Associated Recombinant Proteins Name Specification and purity Expression system Protein label Availability View Details
Associated Antibodies
Name Specifications Species reactivity Application Availability View Details
Associated Approved Drugs Associated Active Ligands Associated Diseases Name Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Settings Agree All Decline
Shall we send you a message when we have discounts available?
Remind me later Allow
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.