224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Transcription factor HES-5 |
|---|
Gene and Protein Information
| Gene ID | 388585 |
|---|---|
| Uniprot Accession IDs | Q5TA89 B9DI85 |
| Ensembl ID | ENSP00000367714 |
| Symbol | BHLHB38 bHLHb38 |
| Sequence | MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 107973860 | HES5 | hes family bHLH transcription factor 5 | 9598 | VGNC:11446 | OMA, EggNOG |
| Mouse | 15208 | Hes5 | hes family bHLH transcription factor 5 | 10090 | MGI:104876 | Inparanoid, OMA, EggNOG |
| Rat | 79225 | Hes5 | hes family bHLH transcription factor 5 | 10116 | RGD:621340 | Inparanoid, OMA, EggNOG |
| Dog | 489614 | HES5 | hes family bHLH transcription factor 5 | 9615 | VGNC:41666 | Inparanoid, OMA, EggNOG |
| Cow | 787633 | HES5 | hes family bHLH transcription factor 5 | 9913 | VGNC:29822 | Inparanoid, OMA, EggNOG |
| Opossum | 100027928 | HES5 | hes family bHLH transcription factor 5 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 419392 | HES5 | hes family bHLH transcription factor 5 | 9031 | CGNC:773 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100562263 | hes5 | hes family bHLH transcription factor 5 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 733463 | hes5.1 | hes family bHLH transcription factor 5 | 8364 | XB-GENE-481135 | Inparanoid, OMA |
| Xenopus | 100271766 | hes8 | hairy and enhancer of split 8 | 8364 | XB-GENE-5952810 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.