HES5

DescriptionTranscription factor HES-5

Gene and Protein Information

Gene ID388585
Uniprot Accession IDs Q5TA89 B9DI85
Ensembl ID ENSP00000367714
Symbol BHLHB38 bHLHb38
Sequence
MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp107973860HES5hes family bHLH transcription factor 59598VGNC:11446OMA, EggNOG
Mouse15208Hes5hes family bHLH transcription factor 510090MGI:104876Inparanoid, OMA, EggNOG
Rat79225Hes5hes family bHLH transcription factor 510116RGD:621340Inparanoid, OMA, EggNOG
Dog489614HES5hes family bHLH transcription factor 59615VGNC:41666Inparanoid, OMA, EggNOG
Cow787633HES5hes family bHLH transcription factor 59913VGNC:29822Inparanoid, OMA, EggNOG
Opossum100027928HES5hes family bHLH transcription factor 513616Inparanoid, OMA, EggNOG
Chicken419392HES5hes family bHLH transcription factor 59031CGNC:773Inparanoid, OMA, EggNOG
Anole lizard100562263hes5hes family bHLH transcription factor 528377Inparanoid, OMA, EggNOG
Xenopus733463hes5.1hes family bHLH transcription factor 58364XB-GENE-481135Inparanoid, OMA
Xenopus100271766hes8hairy and enhancer of split 88364XB-GENE-5952810OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.