224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Fos-related antigen 1 |
|---|
Gene and Protein Information
| Gene ID | 8061 |
|---|---|
| Uniprot Accession IDs | P15407 B4DR11 Q6FG51 FRA-1 |
| Ensembl ID | ENSP00000310170 |
| Symbol | FRA1 FRA FRA1 fra-1 |
| Family | Belongs to the bZIP family. Fos subfamily. |
| Sequence | MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 745919 | FOSL1 | FOS like 1, AP-1 transcription factor subunit | 9598 | VGNC:6556 | OMA, EggNOG |
| Macaque | 106993191 | FOSL1 | FOS like 1, AP-1 transcription factor subunit | 9544 | OMA, EggNOG | |
| Mouse | 14283 | Fosl1 | fos-like antigen 1 | 10090 | MGI:107179 | Inparanoid, OMA, EggNOG |
| Rat | 25445 | Fosl1 | FOS like 1, AP-1 transcription factor subunit | 10116 | RGD:2627 | Inparanoid, OMA, EggNOG |
| Dog | 483724 | FOSL1 | FOS like 1, AP-1 transcription factor subunit | 9615 | VGNC:40942 | Inparanoid, OMA, EggNOG |
| Horse | 100051930 | FOSL1 | FOS like 1, AP-1 transcription factor subunit | 9796 | VGNC:18097 | Inparanoid, OMA, EggNOG |
| Cow | 531389 | FOSL1 | FOS like 1, AP-1 transcription factor subunit | 9913 | VGNC:29075 | Inparanoid, OMA, EggNOG |
| Pig | 100525205 | FOSL1 | FOS like 1, AP-1 transcription factor subunit | 9823 | OMA, EggNOG | |
| Anole lizard | 100552821 | fosb | FosB proto-oncogene, AP-1 transcription factor subunit | 28377 | OMA, EggNOG | |
| Xenopus | 100038288 | fosl1 | FOS-like antigen 1 | 8364 | XB-GENE-6257957 | Inparanoid, OMA, EggNOG |
| Zebrafish | 564241 | fosl1a | FOS-like antigen 1a | 7955 | ZDB-GENE-061207-7 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.