🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

FOLR1

DescriptionFolate receptor alpha

Gene and Protein Information

Gene ID2348
Uniprot Accession IDs P15328 Q53EW2 Q6FGT8 Q6LC90 Q9UCT2 FR-alpha
Ensembl ID ENSP00000377284
Symbol FOLR FBP FOLR
FamilyBelongs to the folate receptor family.
Sequence
MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp451401FOLR1folate receptor 19598VGNC:11775OMA, EggNOG
Macaque718388FOLR1folate receptor 19544Inparanoid, OMA, EggNOG
Mouse14275Folr1folate receptor 1 (adult)10090MGI:95568Inparanoid, OMA
Rat171049Folr1folate receptor 110116RGD:71032Inparanoid, OMA, EggNOG
Dog609612FOLR1folate receptor 19615Inparanoid, OMA, EggNOG
Horse100059683LOC100059683folate receptor alpha-like9796Inparanoid, OMA
Cow539750FOLR1folate receptor 1 (adult)9913OMA, EggNOG
PigFOLR1folate receptor alpha precursor [Source:RefSeq peptide;Acc:NP_999476]9823Inparanoid, OMA
Opossum100015645LOC100015645folate receptor alpha-like13616OMA, EggNOG
Chicken395638FOLR1folate receptor 19031CGNC:49417OMA, EggNOG
Xenopus394697folr1folate receptor 1 (adult)8364XB-GENE-948101OMA, EggNOG
Zebrafish100073336zgc:165502zgc:1655027955ZDB-GENE-070615-23Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.