224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Fibroblast growth factor 17 |
|---|
Gene and Protein Information
| Gene ID | 8822 |
|---|---|
| Uniprot Accession IDs | O60258 B7ZLG4 Q2M2W1 FGF-17 |
| Ensembl ID | ENSP00000352414 |
| Symbol | HH20 FGF-13 FGF-17 |
| Family | Belongs to the heparin-binding growth factors family. |
| Sequence | MGAARLLPNLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 472708 | FGF17 | fibroblast growth factor 17 | 9598 | VGNC:12011 | OMA, EggNOG |
| Mouse | 14171 | Fgf17 | fibroblast growth factor 17 | 10090 | MGI:1202401 | Inparanoid, OMA, EggNOG |
| Rat | 29368 | Fgf17 | fibroblast growth factor 17 | 10116 | RGD:2607 | Inparanoid, OMA, EggNOG |
| Dog | 607952 | FGF17 | fibroblast growth factor 17 | 9615 | VGNC:40844 | Inparanoid, OMA, EggNOG |
| Horse | 100056444 | FGF17 | fibroblast growth factor 17 | 9796 | VGNC:18014 | Inparanoid, OMA, EggNOG |
| Cow | FGF17 | fibroblast growth factor 17 [Source:HGNC Symbol;Acc:HGNC:3673] | 9913 | OMA, EggNOG | ||
| Pig | 100155720 | FGF17 | fibroblast growth factor 17 | 9823 | OMA, EggNOG | |
| Opossum | 100030474 | FGF17 | fibroblast growth factor 17 | 13616 | Inparanoid, EggNOG | |
| Platypus | 100088500 | FGF17 | fibroblast growth factor 17 | 9258 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 407737 | fgf17 | fibroblast growth factor 17 | 7955 | ZDB-GENE-040621-1 | Inparanoid, OMA |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.