224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Fibroblast growth factor 5 |
|---|
Gene and Protein Information
| Gene ID | 2250 |
|---|---|
| Uniprot Accession IDs | P12034 B2R554 O75846 Q3Y8M3 Q8NF90 FGF-5 |
| Ensembl ID | ENSP00000311697 |
| Symbol | HBGF-5 TCMGLY Smag-82 |
| Family | Belongs to the heparin-binding growth factors family. |
| Sequence | MSLSFLLLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | FGF5 | fibroblast growth factor 5 [Source:HGNC Symbol;Acc:HGNC:3683] | 9598 | OMA, EggNOG | ||
| Mouse | 14176 | Fgf5 | fibroblast growth factor 5 | 10090 | MGI:95519 | Inparanoid, OMA, EggNOG |
| Rat | 60662 | Fgf5 | fibroblast growth factor 5 | 10116 | RGD:620129 | Inparanoid, OMA, EggNOG |
| Dog | 608459 | FGF5 | fibroblast growth factor 5 | 9615 | VGNC:40851 | Inparanoid, OMA, EggNOG |
| Horse | 100060219 | FGF5 | fibroblast growth factor 5 | 9796 | VGNC:18018 | Inparanoid, OMA, EggNOG |
| Cow | 536771 | FGF5 | fibroblast growth factor 5 | 9913 | VGNC:28980 | Inparanoid, OMA, EggNOG |
| Opossum | 100014690 | FGF5 | fibroblast growth factor 5 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 770457 | FGF5 | fibroblast growth factor 5 | 9031 | CGNC:8278 | Inparanoid, OMA |
| Anole lizard | FGF5 | fibroblast growth factor 5 [Source:HGNC Symbol;Acc:HGNC:3683] | 28377 | Inparanoid, OMA, EggNOG | ||
| Xenopus | 100486176 | fgf5 | fibroblast growth factor 5 | 8364 | XB-GENE-482346 | Inparanoid, OMA, EggNOG |
| Zebrafish | 494454 | fgf5 | fibroblast growth factor 5 | 7955 | ZDB-GENE-050201-6 | Inparanoid, OMA, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.