🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

FIS1

DescriptionMitochondrial fission 1 protein

Gene and Protein Information

Gene ID51024
Uniprot Accession IDs Q9Y3D6 Q9BTP3
Ensembl ID ENSP00000223136
Symbol TTC11 TTC11 CGI-135
FamilyBelongs to the FIS1 family.
Sequence
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp740858FIS1fission, mitochondrial 19598OMA, EggNOG
Macaque714444FIS1fission, mitochondrial 19544Inparanoid, OMA, EggNOG
Mouse66437Fis1fission, mitochondrial 110090MGI:1913687Inparanoid, OMA, EggNOG
Rat288584Fis1fission, mitochondrial 110116RGD:1306668Inparanoid, OMA
Dog479728FIS1fission, mitochondrial 19615VGNC:40884Inparanoid, OMA, EggNOG
Horse100059592FIS1fission, mitochondrial 19796VGNC:18046Inparanoid, OMA, EggNOG
Cow615565FIS1fission, mitochondrial 19913VGNC:29014Inparanoid, OMA, EggNOG
Opossum100016700FIS1fission, mitochondrial 113616Inparanoid, OMA, EggNOG
Anole lizard100557039fis1fission, mitochondrial 128377Inparanoid, OMA, EggNOG
XenopusFIS1fission, mitochondrial 1 [Source:HGNC Symbol;Acc:HGNC:21689]8364OMA, EggNOG
C. elegans184409fis-2Mitochondrial fission 1 protein6239Inparanoid, OMA, EggNOG
Fruitfly49892Fis1Fission, mitochondrial 17227FBgn0039969Inparanoid, EggNOG
S.cerevisiae854745FIS1Fis1p4932S000001327Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.