224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Fos-related antigen 2 |
|---|
Gene and Protein Information
| Gene ID | 2355 |
|---|---|
| Uniprot Accession IDs | P15408 B2RD58 B3KP27 B4DYV4 Q6FG46 FRA-2 |
| Ensembl ID | ENSP00000264716 |
| Symbol | FRA2 FRA2 |
| Family | Belongs to the bZIP family. Fos subfamily. |
| Sequence | MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 703068 | FOSL2 | FOS like 2, AP-1 transcription factor subunit | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 14284 | Fosl2 | fos-like antigen 2 | 10090 | MGI:102858 | Inparanoid, OMA, EggNOG |
| Rat | 25446 | Fosl2 | FOS like 2, AP-1 transcription factor subunit | 10116 | RGD:2628 | Inparanoid, OMA |
| Dog | 608412 | FOSL2 | FOS like 2, AP-1 transcription factor subunit | 9615 | VGNC:40943 | Inparanoid, OMA, EggNOG |
| Horse | 100071081 | FOSL2 | FOS like 2, AP-1 transcription factor subunit | 9796 | VGNC:18098 | Inparanoid, OMA, EggNOG |
| Cow | 509889 | FOSL2 | FOS like 2, AP-1 transcription factor subunit | 9913 | VGNC:29076 | Inparanoid, OMA, EggNOG |
| Opossum | FOSL2 | FOS like 2, AP-1 transcription factor subunit [Source:HGNC Symbol;Acc:HGNC:3798] | 13616 | Inparanoid, EggNOG | ||
| Platypus | FOSL2 | FOS like 2, AP-1 transcription factor subunit [Source:HGNC Symbol;Acc:HGNC:3798] | 9258 | OMA, EggNOG | ||
| Chicken | 421416 | FOSL2 | FOS like 2, AP-1 transcription factor subunit | 9031 | CGNC:7631 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100563265 | fosl2 | FOS like 2, AP-1 transcription factor subunit | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100494449 | fosl2 | FOS-like antigen 2 | 8364 | XB-GENE-6258093 | Inparanoid, OMA, EggNOG |
| Zebrafish | 558921 | fosl2 | fos-like antigen 2 | 7955 | ZDB-GENE-070209-164 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.