224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | High mobility group protein B2 |
|---|
Gene and Protein Information
| Gene ID | 3148 |
|---|---|
| Uniprot Accession IDs | P26583 B2R4K8 D3DP37 Q5U072 |
| Ensembl ID | ENSP00000296503 |
| Symbol | HMG2 HMG2 |
| Family | Belongs to the HMGB family. |
| Sequence | MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 461606 | HMGB2 | high mobility group box 2 | 9598 | VGNC:613 | OMA, EggNOG |
| Macaque | 697057 | HMGB2 | high mobility group box 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 97165 | Hmgb2 | high mobility group box 2 | 10090 | MGI:96157 | Inparanoid, OMA, EggNOG |
| Rat | 29395 | Hmgb2 | high mobility group box 2 | 10116 | Inparanoid, OMA | |
| Dog | 486068 | HMGB2 | high mobility group box 2 | 9615 | VGNC:41710 | Inparanoid, OMA, EggNOG |
| Horse | 100061162 | HMGB2 | high mobility group box 2 | 9796 | VGNC:18803 | Inparanoid, OMA, EggNOG |
| Cow | 540444 | HMGB2 | high mobility group box 2 | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 397130 | HMGB2 | high mobility group box 2 | 9823 | Inparanoid, EggNOG | |
| Opossum | 100014287 | HMGB2 | high mobility group box 2 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 396482 | HMGB2 | high mobility group box 2 | 9031 | CGNC:8169 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100553705 | hmgb2 | high mobility group box 2 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 641484 | hmgb2a | high mobility group box 2a | 7955 | ZDB-GENE-051120-126 | Inparanoid, OMA, EggNOG |
| C. elegans | 175890 | hmg-1.2 | High mobility group protein 1.2 | 6239 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / chromatin/chromatin-binding protein / High mobility group protein B2
protein / nucleic acid binding / signaling molecule / High mobility group protein B2
protein / nucleic acid binding / HMG box transcription factor / High mobility group protein B2
protein / nucleic acid binding / chromatin/chromatin-binding protein / High mobility group protein B2
protein / nucleic acid binding / signaling molecule / High mobility group protein B2
protein / nucleic acid binding / HMG box transcription factor / High mobility group protein B2
DTO Classes
protein / Nucleic acid binding / DNA binding protein / Chromatin/chromatin-binding protein / High mobility group protein B2
protein / Nucleic acid binding / DNA binding protein / Chromatin/chromatin-binding protein / High mobility group protein B2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.