224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Hyaluronan and proteoglycan link protein 4 |
|---|
Gene and Protein Information
| Gene ID | 404037 |
|---|---|
| Uniprot Accession IDs | Q86UW8 A5PKW5 Q96PW2 |
| Ensembl ID | ENSP00000291481 |
| Symbol | BRAL2 KIAA1926 BRAL2 |
| Family | Belongs to the HAPLN family. |
| Sequence | MVCARAALGPGALWAAAWGVLLLTAPAGAQRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKLTFAEAQRACAEQDGILASAEQLHAAWRDGLDWCNAGWLRDGSVQYPVNRPREPCGGLGGTGSAGGGGDANGGLRNYGYRHNAEERYDAFCFTSNLPGRVFFLKPLRPVPFSGAARACAARGAAVAKVGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRARCGGRRPGVRSLGFPDATRRLFGVYCYRAPGAPDPAPGGWGWGWAGGGGWAGGARDPAAWTPLHV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 468776 | HAPLN4 | hyaluronan and proteoglycan link protein 4 | 9598 | VGNC:2551 | OMA, EggNOG |
| Macaque | 719748 | HAPLN4 | hyaluronan and proteoglycan link protein 4 | 9544 | OMA, EggNOG | |
| Mouse | 330790 | Hapln4 | hyaluronan and proteoglycan link protein 4 | 10090 | MGI:2679531 | Inparanoid, OMA, EggNOG |
| Rat | 361129 | Hapln4 | hyaluronan and proteoglycan link protein 4 | 10116 | RGD:1308408 | Inparanoid, OMA |
| Dog | 100686618 | HAPLN4 | hyaluronan and proteoglycan link protein 4 | 9615 | VGNC:41595 | Inparanoid, OMA, EggNOG |
| Horse | HAPLN4 | hyaluronan and proteoglycan link protein 4 [Source:HGNC Symbol;Acc:HGNC:31357] | 9796 | OMA, EggNOG | ||
| Cow | 539254 | HAPLN4 | hyaluronan and proteoglycan link protein 4 | 9913 | VGNC:52237 | Inparanoid, OMA, EggNOG |
| Opossum | 100011821 | HAPLN4 | hyaluronan and proteoglycan link protein 4 | 13616 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100490942 | hapln4 | hyaluronan and proteoglycan link protein 4 | 8364 | XB-GENE-922316 | Inparanoid, OMA, EggNOG |
| Zebrafish | 559818 | hapln4 | hyaluronan and proteoglycan link protein 4 | 7955 | ZDB-GENE-060503-243 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / extracellular matrix protein / extracellular matrix glycoprotein / Hyaluronan and proteoglycan link protein 4
protein / extracellular matrix protein / extracellular matrix glycoprotein / Hyaluronan and proteoglycan link protein 4
DTO Classes
protein / Extracellular structure / Extracellular matrix glycoprotein / Hyaluronan and proteoglycan link protein 4
protein / Extracellular structure / Extracellular matrix glycoprotein / Hyaluronan and proteoglycan link protein 4
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.