224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | N-arachidonyl glycine receptor |
|---|
Gene and Protein Information
| Gene ID | 2841 |
|---|---|
| Uniprot Accession IDs | Q14330 Q6GTM3 Q96HI6 Q9H2L2 NAGly receptor |
| Ensembl ID | ENSP00000343428 |
| Symbol | GPCRW |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MITLNNQDQPVPFNSSHPDEYKIAALVFYSCIFIIGLFVNITALWVFSCTTKKRTTVTIYMMNVALVDLIFIMTLPFRMFYYAKDEWPFGEYFCQILGALTVFYPSIALWLLAFISADRYMAIVQPKYAKELKNTCKAVLACVGVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIYLKAVNVLNLTRLTFFFLIPLFIMIGCYLVIIHNLLHGRTSKLKPKVKEKSIRIIITLLVQVLVCFMPFHICFAFLMLGTGENSYNPWGAFTTFLMNLSTCLDVILYYIVSKQFQARVISVMLYRNYLRSMRRKSFRSGSLRSLSNINSEML Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 738311 | GPR18 | G protein-coupled receptor 18 | 9598 | VGNC:5065 | OMA, EggNOG |
| Macaque | 698714 | GPR18 | G protein-coupled receptor 18 | 9544 | Inparanoid, OMA | |
| Mouse | 110168 | Gpr18 | G protein-coupled receptor 18 | 10090 | MGI:107859 | Inparanoid, OMA, EggNOG |
| Rat | 679957 | Gpr18 | G protein-coupled receptor 18 | 10116 | RGD:1304889 | Inparanoid, OMA, EggNOG |
| Dog | 485531 | GPR18 | G protein-coupled receptor 18 | 9615 | VGNC:41420 | Inparanoid, OMA, EggNOG |
| Horse | 100147633 | GPR18 | G protein-coupled receptor 18 | 9796 | VGNC:18531 | Inparanoid, OMA, EggNOG |
| Cow | 540038 | GPR18 | G protein-coupled receptor 18 | 9913 | VGNC:29574 | Inparanoid, OMA, EggNOG |
| Chicken | 100858263 | GPR18 | G protein-coupled receptor 18 | 9031 | CGNC:66127 | OMA, EggNOG |
| Anole lizard | 103278302 | gpr18 | G protein-coupled receptor 18 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | GPR18 | G protein-coupled receptor 18 [Source:HGNC Symbol;Acc:HGNC:4472] | 8364 | OMA, EggNOG | ||
| Zebrafish | 556711 | gpr18 | G protein-coupled receptor 18 | 7955 | ZDB-GENE-070912-159 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / N-arachidonyl glycine receptor
protein / G-protein coupled receptor / Class A rhodopsin like / N-arachidonyl glycine receptor
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.