GPR1

DescriptionG-protein coupled receptor 1

Gene and Protein Information

Gene ID2825
Uniprot Accession IDs P46091 A5JUU6 A8K4L1 Q53TR9 Q6NVX4
Ensembl ID ENSP00000480405
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp470621GPR1G protein-coupled receptor 19598VGNC:1948OMA, EggNOG
Macaque707120GPR1G protein-coupled receptor 19544Inparanoid, OMA, EggNOG
Mouse241070Gpr1G protein-coupled receptor 110090MGI:2385324Inparanoid, OMA, EggNOG
Rat25457Gpr1G protein-coupled receptor 110116RGD:2728Inparanoid, OMA, EggNOG
Dog478882GPR1G protein-coupled receptor 19615VGNC:41390Inparanoid, OMA, EggNOG
Horse100068488GPR1G protein-coupled receptor 19796VGNC:18504Inparanoid, OMA, EggNOG
Cow509707GPR1G protein-coupled receptor 19913VGNC:29542Inparanoid, OMA, EggNOG
Pig100415936GPR1G protein-coupled receptor 19823Inparanoid, OMA, EggNOG
Opossum100017108GPR1G protein-coupled receptor 113616Inparanoid, OMA, EggNOG
Platypus100083855GPR1G protein-coupled receptor 19258Inparanoid, OMA, EggNOG
Chicken424101GPR1G protein-coupled receptor 19031CGNC:6515Inparanoid, OMA, EggNOG
Anole lizard100552338gpr1G protein-coupled receptor 128377Inparanoid, OMA, EggNOG
XenopusGPR1G protein-coupled receptor 1 [Source:HGNC Symbol;Acc:HGNC:4463]8364OMA, EggNOG
Zebrafish100004124gpr1G protein-coupled receptor 17955ZDB-GENE-091204-457Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    G-protein coupled receptor 1
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    G-protein coupled receptor 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.