224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | G-protein coupled receptor 1 |
|---|
Gene and Protein Information
| Gene ID | 2825 |
|---|---|
| Uniprot Accession IDs | P46091 A5JUU6 A8K4L1 Q53TR9 Q6NVX4 |
| Ensembl ID | ENSP00000480405 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 470621 | GPR1 | G protein-coupled receptor 1 | 9598 | VGNC:1948 | OMA, EggNOG |
| Macaque | 707120 | GPR1 | G protein-coupled receptor 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 241070 | Gpr1 | G protein-coupled receptor 1 | 10090 | MGI:2385324 | Inparanoid, OMA, EggNOG |
| Rat | 25457 | Gpr1 | G protein-coupled receptor 1 | 10116 | RGD:2728 | Inparanoid, OMA, EggNOG |
| Dog | 478882 | GPR1 | G protein-coupled receptor 1 | 9615 | VGNC:41390 | Inparanoid, OMA, EggNOG |
| Horse | 100068488 | GPR1 | G protein-coupled receptor 1 | 9796 | VGNC:18504 | Inparanoid, OMA, EggNOG |
| Cow | 509707 | GPR1 | G protein-coupled receptor 1 | 9913 | VGNC:29542 | Inparanoid, OMA, EggNOG |
| Pig | 100415936 | GPR1 | G protein-coupled receptor 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100017108 | GPR1 | G protein-coupled receptor 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100083855 | GPR1 | G protein-coupled receptor 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 424101 | GPR1 | G protein-coupled receptor 1 | 9031 | CGNC:6515 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100552338 | gpr1 | G protein-coupled receptor 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | GPR1 | G protein-coupled receptor 1 [Source:HGNC Symbol;Acc:HGNC:4463] | 8364 | OMA, EggNOG | ||
| Zebrafish | 100004124 | gpr1 | G protein-coupled receptor 1 | 7955 | ZDB-GENE-091204-457 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / G-protein coupled receptor 1
protein / G-protein coupled receptor / Class A rhodopsin like / G-protein coupled receptor 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.