224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | HAUS augmin-like complex subunit 7 |
|---|
Gene and Protein Information
| Gene ID | 55559 |
|---|---|
| Uniprot Accession IDs | Q99871 B4DUH6 D3DWT9 Q96HS8 Q9NP54 Q9UFH9 |
| Ensembl ID | ENSP00000359230 |
| Symbol | UCHL5IP UIP1 UIP1 UCHL5IP |
| Family | Belongs to the HAUS7 family. |
| Sequence | MGGARLGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVEVFGKLKDLNCPFLEGLYITEPKTIQELLCSPSEYRLEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCAPDDQELLKGCACAQKQLHFMDQLLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPECDPWPLDMQPLLNKQSDDWQWASASAKSEEEEKLAELARQLQESAAKLHALRTEYFAQHEQGAAAGAADISTLDQKLRLVTSDFHQLILAFLQVYDDELGECCQRPGPDLHPCGPIIQATHQNLTSYSQLLQVVMAVADTSAKAVETVKKQQGEQICWGGSSSVMSLATKMNELMEK Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 73738 | Haus7 | HAUS augmin-like complex, subunit 7 | 10090 | MGI:1920988 | Inparanoid, OMA |
| Dog | 612496 | HAUS7 | HAUS augmin like complex subunit 7 | 9615 | VGNC:41607 | Inparanoid, OMA |
| Anole lizard | 100552309 | haus7 | HAUS augmin like complex subunit 7 | 28377 | Inparanoid, OMA | |
| Xenopus | 100145089 | haus7 | HAUS augmin like complex subunit 7 | 8364 | XB-GENE-5773864 | Inparanoid, OMA |
| Zebrafish | 553483 | haus7 | HAUS augmin-like complex, subunit 7 | 7955 | ZDB-GENE-050506-15 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.