🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

HDAC1

DescriptionHistone deacetylase 1

Gene and Protein Information

Gene ID3065
Uniprot Accession IDs Q13547 Q92534 HD1
Ensembl ID ENSP00000362649
Symbol RPD3L1 HD1 RPD3 KDAC1 GON-10 RPD3L1
FamilyBelongs to the histone deacetylase family. HD type 1 subfamily.
Sequence
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque708441HDAC1histone deacetylase 19544OMA, EggNOG
Mouse433759Hdac1histone deacetylase 110090MGI:108086Inparanoid, OMA
Rat297893Hdac1histone deacetylase 110116RGD:1309799Inparanoid, OMA
Dog487309HDAC1histone deacetylase 19615VGNC:50625Inparanoid, OMA, EggNOG
Horse100070281HDAC1histone deacetylase 19796VGNC:50592Inparanoid, OMA
Cow404126HDAC1histone deacetylase 19913VGNC:49065Inparanoid, OMA, EggNOG
Opossum100032301HDAC1histone deacetylase 113616OMA, EggNOG
PlatypusHDAC1histone deacetylase 1 [Source:HGNC Symbol;Acc:HGNC:4852]9258OMA, EggNOG
Chicken373961HDAC1histone deacetylase 19031CGNC:2394Inparanoid, OMA
Anole lizard100554517hdac1histone deacetylase 128377Inparanoid, OMA, EggNOG
Xenopus594953hdac1histone deacetylase 18364XB-GENE-479583Inparanoid, OMA
Zebrafish192302hdac1histone deacetylase 17955ZDB-GENE-020419-32Inparanoid, EggNOG
Fruitfly38565HDAC1Histone deacetylase 17227FBgn0015805Inparanoid, OMA
S.cerevisiae855386RPD3histone deacetylase RPD34932S000005274Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    deacetylase    /    Histone deacetylase 1
protein    /    hydrolase    /    reductase    /    Histone deacetylase 1
protein    /    hydrolase    /    nucleic acid binding    /    Histone deacetylase 1
DTO Classes
protein    /    Epigenetic regulator    /    Eraser    /    Histone deacetylase    /    HDAC class I    /    Histone deacetylase 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.