224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | HLA class II histocompatibility antigen gamma chain |
|---|
Gene and Protein Information
| Gene ID | 972 |
|---|---|
| Uniprot Accession IDs | P04233 A8K7R1 B4DNE8 D3DQG3 D3DQG4 Q14597 Q29832 Q5U0J8 Q8SNA0 Q8WLP6 |
| Ensembl ID | ENSP00000009530 |
| Symbol | DHLAG II p33 DHLAG HLADG Ia-GAMMA |
| Sequence | MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 462191 | CD74 | CD74 molecule | 9598 | VGNC:6387 | Inparanoid, OMA |
| Macaque | 710820 | CD74 | CD74 molecule | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 16149 | Cd74 | CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated) | 10090 | MGI:96534 | Inparanoid, OMA |
| Rat | 25599 | Cd74 | CD74 molecule | 10116 | RGD:2313 | Inparanoid, OMA, EggNOG |
| Dog | 479329 | CD74 | CD74 molecule | 9615 | VGNC:38972 | Inparanoid, OMA, EggNOG |
| Opossum | 100029179 | CD74 | CD74 molecule | 13616 | Inparanoid, EggNOG | |
| Platypus | 100079053 | CD74 | CD74 molecule | 9258 | Inparanoid, OMA | |
| Anole lizard | 100555195 | cd74 | CD74 molecule | 28377 | Inparanoid, OMA | |
| Xenopus | 100486651 | cd74 | CD74 molecule | 8364 | XB-GENE-922847 | Inparanoid, OMA |
| Zebrafish | 58113 | cd74a | CD74 molecule, major histocompatibility complex, class II invariant chain a | 7955 | ZDB-GENE-000901-1 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.