224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Gastrin |
|---|
Gene and Protein Information
| Gene ID | 2520 |
|---|---|
| Uniprot Accession IDs | P01350 P78463 P78464 |
| Ensembl ID | ENSP00000331358 |
| Symbol | GAS GAS |
| Family | Belongs to the gastrin/cholecystokinin family. |
| Sequence | MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 468262 | GAST | gastrin | 9598 | VGNC:12143 | OMA, EggNOG |
| Mouse | 14459 | Gast | gastrin | 10090 | MGI:104768 | Inparanoid, OMA, EggNOG |
| Rat | 25320 | Gast | gastrin | 10116 | RGD:2662 | Inparanoid, OMA, EggNOG |
| Dog | 100685087 | GAST | gastrin | 9615 | VGNC:41121 | Inparanoid, OMA, EggNOG |
| Horse | 100034214 | GAST | gastrin | 9796 | VGNC:49456 | Inparanoid, OMA, EggNOG |
| Cow | 280800 | GAST | gastrin | 9913 | VGNC:29264 | Inparanoid, OMA, EggNOG |
| Pig | 445524 | GAST | gastrin | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100013059 | GAST | gastrin | 13616 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.