🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

FGF19

DescriptionFibroblast growth factor 19

Gene and Protein Information

Gene ID9965
Uniprot Accession IDs O95750 FGF-19
Ensembl ID ENSP00000294312
FamilyBelongs to the heparin-binding growth factors family.
Sequence
MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp747710FGF19fibroblast growth factor 199598VGNC:1054OMA, EggNOG
Mouse14170Fgf15fibroblast growth factor 1510090MGI:1096383Inparanoid, OMA, EggNOG
Rat170582Fgf19fibroblast growth factor 1910116RGD:620166Inparanoid, OMA, EggNOG
Dog483681FGF19fibroblast growth factor 199615VGNC:40846Inparanoid, OMA, EggNOG
Cow521475FGF19fibroblast growth factor 199913VGNC:28975Inparanoid, OMA, EggNOG
Pig100518950FGF19fibroblast growth factor 199823OMA, EggNOG
Opossum100021575FGF19fibroblast growth factor 1913616Inparanoid, OMA, EggNOG
Chicken395394FGF19fibroblast growth factor 199031CGNC:66203Inparanoid, OMA
Anole lizard100565023fgf19fibroblast growth factor 1928377Inparanoid, OMA, EggNOG
Xenopus100217329fgf19fibroblast growth factor 198364XB-GENE-486499Inparanoid, OMA, EggNOG
Zebrafish368245fgf19fibroblast growth factor 197955ZDB-GENE-030729-32Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    growth factor    /    Fibroblast growth factor 19
DTO Classes
protein    /    Signaling    /    Growth factor    /    Fibroblast growth factor 19

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.