224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Fibronectin type III domain-containing protein 5 |
|---|
Gene and Protein Information
| Gene ID | 252995 |
|---|---|
| Uniprot Accession IDs | Q8NAU1 A6NMC9 D3DPQ6 Q6P6D9 Q7Z676 |
| Ensembl ID | ENSP00000362570 |
| Symbol | FRCP2 FRCP2 irisin |
| Sequence | MHPGSPSAWPPRARAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKI |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 746970 | FNDC5 | fibronectin type III domain containing 5 | 9598 | VGNC:10645 | OMA, EggNOG |
| Mouse | 384061 | Fndc5 | fibronectin type III domain containing 5 | 10090 | MGI:1917614 | Inparanoid, OMA, EggNOG |
| Rat | 260327 | Fndc5 | fibronectin type III domain containing 5 | 10116 | RGD:708525 | Inparanoid, OMA, EggNOG |
| Dog | 487302 | FNDC5 | fibronectin type III domain containing 5 | 9615 | VGNC:40931 | Inparanoid, OMA, EggNOG |
| Horse | 100146454 | FNDC5 | fibronectin type III domain containing 5 | 9796 | VGNC:50695 | Inparanoid, OMA, EggNOG |
| Pig | 100622587 | FNDC5 | fibronectin type III domain containing 5 | 9823 | OMA, EggNOG | |
| Opossum | FNDC5 | fibronectin type III domain containing 5 [Source:HGNC Symbol;Acc:HGNC:20240] | 13616 | Inparanoid, OMA, EggNOG | ||
| Platypus | FNDC5 | fibronectin type III domain containing 5 [Source:HGNC Symbol;Acc:HGNC:20240] | 9258 | OMA, EggNOG | ||
| Chicken | 419667 | FNDC5 | fibronectin type III domain containing 5 | 9031 | CGNC:2603 | Inparanoid, OMA, EggNOG |
| Anole lizard | FNDC5 | fibronectin type III domain containing 5 [Source:HGNC Symbol;Acc:HGNC:20240] | 28377 | OMA, EggNOG | ||
| Zebrafish | 555635 | fndc5b | fibronectin type III domain containing 5b | 7955 | ZDB-GENE-060503-916 | OMA, EggNOG |
| Zebrafish | 795265 | fndc5a | fibronectin type III domain containing 5a | 7955 | ZDB-GENE-061207-40 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.