224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Peptidyl-prolyl cis-trans isomerase FKBP5 |
|---|
Gene and Protein Information
| Gene ID | 2289 |
|---|---|
| Uniprot Accession IDs | Q13451 F5H7R1 Q59EB8 Q5TGM6 PPIase FKBP5 |
| Ensembl ID | ENSP00000444810 |
| Symbol | AIG6 FKBP51 P54 AIG6 FKBP51 FKBP54 PPIase Ptg-10 |
| Sequence | MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 14229 | Fkbp5 | FK506 binding protein 5 | 10090 | MGI:104670 | Inparanoid, OMA |
| Rat | 361810 | Fkbp5 | FK506 binding protein 5 | 10116 | RGD:1309155 | Inparanoid, OMA |
| Dog | 481759 | FKBP5 | FK506 binding protein 5 | 9615 | VGNC:40891 | Inparanoid, OMA |
| Horse | 100053546 | FKBP5 | FK506 binding protein 5 | 9796 | VGNC:18052 | Inparanoid, OMA |
| Cow | 535704 | FKBP5 | FK506 binding protein 5 | 9913 | VGNC:29024 | Inparanoid, OMA |
| Pig | 100155423 | FKBP5 | FK506 binding protein 5 | 9823 | Inparanoid, OMA | |
| Opossum | 100028545 | FKBP5 | FK506 binding protein 5 | 13616 | Inparanoid, OMA | |
| Anole lizard | 100551895 | fkbp5 | FK506 binding protein 5 | 28377 | Inparanoid, OMA | |
| Zebrafish | 368924 | fkbp5 | FK506 binding protein 5 | 7955 | ZDB-GENE-030616-630 | Inparanoid, OMA |
| C. elegans | 180371 | fkb-6 | Peptidylprolyl isomerase | 6239 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.