224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Fatty acid-binding protein 5 |
|---|
Gene and Protein Information
| Gene ID | 2171 |
|---|---|
| Uniprot Accession IDs | Q01469 B2R4K0 |
| Ensembl ID | ENSP00000297258 |
| Symbol | EFABP KFABP E-FABP PAFABP PA-FABP |
| Family | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
| Sequence | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 746909 | FABP5 | fatty acid binding protein 5 | 9598 | VGNC:6678 | OMA, EggNOG |
| Mouse | 16592 | Fabp5 | fatty acid binding protein 5, epidermal | 10090 | MGI:101790 | Inparanoid, OMA, EggNOG |
| Rat | 140868 | Fabp5 | fatty acid binding protein 5 | 10116 | RGD:70997 | Inparanoid, OMA, EggNOG |
| Horse | 100057538 | FABP5 | fatty acid binding protein 5 | 9796 | Inparanoid, OMA, EggNOG | |
| Cow | FABP5 | fatty acid binding protein 5 [Source:HGNC Symbol;Acc:HGNC:3560] | 9913 | OMA, EggNOG | ||
| Pig | 574074 | FABP5 | fatty acid binding protein 5 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | FABP5 | fatty acid binding protein 5 [Source:HGNC Symbol;Acc:HGNC:3560] | 13616 | Inparanoid, OMA, EggNOG | ||
| Platypus | 100075490 | FABP5 | fatty acid binding protein 5 | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100555334 | LOC100555334 | fatty acid-binding protein, epidermal | 28377 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.