224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Cyclin-dependent kinase 7 |
|---|
Gene and Protein Information
| Gene ID | 1022 |
|---|---|
| Uniprot Accession IDs | P50613 Q9BS60 Q9UE19 |
| Ensembl ID | ENSP00000256443 |
| Symbol | CAK CAK1 CDKN7 MO15 STK1 CAK CAK1 HCAK MO15 STK1 CDKN7 p39MO15 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
| Sequence | MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 462378 | CDK7 | cyclin dependent kinase 7 | 9598 | VGNC:11877 | OMA, EggNOG |
| Macaque | 699871 | CDK7 | cyclin dependent kinase 7 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12572 | Cdk7 | cyclin-dependent kinase 7 | 10090 | MGI:102956 | Inparanoid, OMA, EggNOG |
| Rat | 171150 | Cdk7 | cyclin-dependent kinase 7 | 10116 | RGD:621124 | Inparanoid, OMA |
| Dog | 608441 | CDK7 | cyclin dependent kinase 7 | 9615 | VGNC:39060 | Inparanoid, OMA, EggNOG |
| Horse | 100049964 | CDK7 | cyclin dependent kinase 7 | 9796 | VGNC:16355 | Inparanoid, OMA, EggNOG |
| Cow | 515462 | CDK7 | cyclin dependent kinase 7 | 9913 | VGNC:27134 | Inparanoid, OMA, EggNOG |
| Pig | 100310797 | CDK7 | cyclin dependent kinase 7 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100019498 | CDK7 | cyclin dependent kinase 7 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100074988 | CDK7 | cyclin dependent kinase 7 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 771294 | CDK7 | cyclin dependent kinase 7 | 9031 | CGNC:10969 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100557869 | cdk7 | cyclin dependent kinase 7 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549973 | cdk7 | cyclin-dependent kinase 7 | 8364 | XB-GENE-485507 | Inparanoid, OMA, EggNOG |
| Zebrafish | 405897 | cdk7 | cyclin-dependent kinase 7 | 7955 | ZDB-GENE-010320-2 | Inparanoid, OMA, EggNOG |
| C. elegans | 171784 | cdk-7 | Cyclin-dependent kinase 7 | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 31441 | Cdk7 | Cyclin-dependent kinase 7 | 7227 | FBgn0263237 | Inparanoid, EggNOG |
| S.cerevisiae | 851450 | KIN28 | TFIIH complex serine/threonine-protein kinase subunit KIN28 | 4932 | S000002266 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.