🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

FCER1G

DescriptionHigh affinity immunoglobulin epsilon receptor subunit gamma

Gene and Protein Information

Gene ID2207
Uniprot Accession IDs P30273 Q5VTW4
Ensembl ID ENSP00000289902
Symbol FCRG
FamilyBelongs to the CD3Z/FCER1G family.
Sequence
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp100612300FCER1GFc fragment of IgE receptor Ig9598VGNC:6818OMA, EggNOG
Macaque720291FCER1GFc fragment of IgE receptor Ig9544Inparanoid, OMA, EggNOG
Mouse14127Fcer1gFc receptor, IgE, high affinity I, gamma polypeptide10090MGI:95496Inparanoid, OMA, EggNOG
Rat25441Fcer1gFc fragment of IgE receptor Ig10116RGD:2599Inparanoid, OMA, EggNOG
Dog403798FCER1GFc fragment of IgE receptor Ig9615VGNC:40802Inparanoid, OMA, EggNOG
Horse100034137FCER1GFc fragment of IgE receptor Ig9796VGNC:17973OMA, EggNOG
Cow282226FCER1GFc fragment of IgE receptor Ig9913VGNC:28931Inparanoid, OMA, EggNOG
Pig397406FCER1GFc fragment of IgE receptor Ig9823Inparanoid, OMA, EggNOG
OpossumFCER1GFc fragment of IgE receptor Ig [Source:HGNC Symbol;Acc:HGNC:3611]13616Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.