🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

HAPLN1

DescriptionHyaluronan and proteoglycan link protein 1

Gene and Protein Information

Gene ID1404
Uniprot Accession IDs P10915 B2R9A9
Ensembl ID ENSP00000274341
Symbol CRTL1 CRT1 CRTL1
FamilyBelongs to the HAPLN family.
Sequence
MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp461765HAPLN1hyaluronan and proteoglycan link protein 19598VGNC:4027OMA, EggNOG
Macaque712501HAPLN1hyaluronan and proteoglycan link protein 19544Inparanoid, OMA, EggNOG
Mouse12950Hapln1hyaluronan and proteoglycan link protein 110090MGI:1337006Inparanoid, OMA, EggNOG
Rat29331Hapln1hyaluronan and proteoglycan link protein 110116RGD:2412Inparanoid, OMA, EggNOG
Dog488921HAPLN1hyaluronan and proteoglycan link protein 19615VGNC:41593Inparanoid, OMA, EggNOG
Horse100034208HAPLN1hyaluronan and proteoglycan link protein 19796VGNC:18691Inparanoid, OMA, EggNOG
Cow281717HAPLN1hyaluronan and proteoglycan link protein 19913VGNC:29749Inparanoid, OMA, EggNOG
Pig445513HAPLN1hyaluronan and proteoglycan link protein 19823Inparanoid, OMA, EggNOG
Opossum100011753HAPLN1hyaluronan and proteoglycan link protein 113616Inparanoid, OMA, EggNOG
Platypus100077131HAPLN1hyaluronan and proteoglycan link protein 19258Inparanoid, OMA, EggNOG
Chicken396475HAPLN1hyaluronan and proteoglycan link protein 19031CGNC:49825Inparanoid, OMA, EggNOG
Anole lizard100555587hapln1hyaluronan and proteoglycan link protein 128377Inparanoid, OMA, EggNOG
Xenopushapln1hyaluronan and proteoglycan link protein 1 [Source:Xenbase;Acc:XB-GENE-6037477]8364OMA, EggNOG
Zebrafish569074hapln1bhyaluronan and proteoglycan link protein 1b7955ZDB-GENE-050920-1Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    extracellular matrix protein    /    extracellular matrix glycoprotein    /    Hyaluronan and proteoglycan link protein 1
DTO Classes
protein    /    Extracellular structure    /    Extracellular matrix glycoprotein    /    Hyaluronan and proteoglycan link protein 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.