224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Heat shock protein beta-6 |
|---|
Gene and Protein Information
| Gene ID | 126393 |
|---|---|
| Uniprot Accession IDs | O14558 O14551 Q6NVI3 Q96MG9 HspB6 |
| Ensembl ID | ENSP00000468057 |
| Symbol | HEL55 Hsp20 PPP1R91 |
| Family | Belongs to the small heat shock protein (HSP20) family. |
| Sequence | MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 745747 | HSPB6 | heat shock protein family B (small) member 6 | 9598 | VGNC:13182 | OMA, EggNOG |
| Macaque | 710760 | HSPB6 | heat shock protein family B (small) member 6 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 243912 | Hspb6 | heat shock protein, alpha-crystallin-related, B6 | 10090 | MGI:2685325 | Inparanoid, OMA, EggNOG |
| Rat | 192245 | Hspb6 | heat shock protein family B (small) member 6 | 10116 | RGD:621554 | Inparanoid, OMA, EggNOG |
| Dog | 484574 | HSPB6 | heat shock protein family B (small) member 6 | 9615 | VGNC:53526 | Inparanoid, OMA, EggNOG |
| Horse | 100146605 | HSPB6 | heat shock protein family B (small) member 6 | 9796 | VGNC:51039 | Inparanoid, OMA, EggNOG |
| Cow | 534551 | HSPB6 | heat shock protein family B (small) member 6 | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 494560 | HSPB6 | heat shock protein family B (small) member 6 | 9823 | OMA, EggNOG | |
| Opossum | HSPB6 | heat shock protein family B (small) member 6 [Source:HGNC Symbol;Acc:HGNC:26511] | 13616 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.