224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Eukaryotic translation initiation factor 1A, Y-chromosomal |
|---|
Gene and Protein Information
| Gene ID | 9086 |
|---|---|
| Uniprot Accession IDs | O14602 Q9BS77 eIF-1A Y isoform |
| Symbol | eIF-4C |
| Family | Belongs to the eIF-1A family. |
| Sequence | MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 449499 | EIF1AY | eukaryotic translation initiation factor 1A, Y-linked | 9598 | Inparanoid, OMA | |
| S.cerevisiae | 855302 | TIF11 | Tif11p | 4932 | S000004873 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / translation initiation factor / Eukaryotic translation initiation factor 1A, Y-chromosomal
protein / nucleic acid binding / translation initiation factor / Eukaryotic translation initiation factor 1A, Y-chromosomal
DTO Classes
protein / Nucleic acid binding / RNA binding protein / Translation factor / Translation initiation factor / Eukaryotic translation initiation factor 1A, Y-chromosomal
protein / Nucleic acid binding / RNA binding protein / Translation factor / Translation initiation factor / Eukaryotic translation initiation factor 1A, Y-chromosomal
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.