224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Isopentenyl-diphosphate Delta-isomerase 1 |
|---|
Gene and Protein Information
| Gene ID | 3422 |
|---|---|
| Uniprot Accession IDs | Q13907 B4E155 Q32Q13 Q53GQ6 Q86U81 Q8WUX8 Q96IZ4 Q9BQ74 |
| Ensembl ID | ENSP00000370748 |
| Symbol | IPP1 IPPI1 |
| Family | Belongs to the IPP isomerase type 1 family. |
| Sequence | MPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 104008078 | IDI1 | isopentenyl-diphosphate delta isomerase 1 | 9598 | VGNC:12346 | OMA, EggNOG |
| Macaque | 710052 | IDI1 | isopentenyl-diphosphate delta isomerase 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 319554 | Idi1 | isopentenyl-diphosphate delta isomerase | 10090 | MGI:2442264 | Inparanoid, OMA, EggNOG |
| Rat | 89784 | Idi1 | isopentenyl-diphosphate delta isomerase 1 | 10116 | RGD:621835 | Inparanoid, OMA, EggNOG |
| Cow | 514293 | IDI1 | isopentenyl-diphosphate delta isomerase 1 | 9913 | Inparanoid, OMA, EggNOG | |
| Opossum | IDI1 | isopentenyl-diphosphate delta isomerase 1 [Source:HGNC Symbol;Acc:HGNC:5387] | 13616 | Inparanoid, OMA, EggNOG | ||
| Chicken | 420459 | IDI1 | isopentenyl-diphosphate delta isomerase 1 | 9031 | CGNC:51263 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100559198 | LOC100559198 | isopentenyl-diphosphate Delta-isomerase 1 | 28377 | OMA, EggNOG | |
| Xenopus | 496783 | idi1 | isopentenyl-diphosphate delta isomerase 1 | 8364 | XB-GENE-492551 | Inparanoid, OMA, EggNOG |
| Zebrafish | 553513 | idi1 | isopentenyl-diphosphate delta isomerase 1 | 7955 | ZDB-GENE-050913-44 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 855986 | IDI1 | isopentenyl-diphosphate delta-isomerase IDI1 | 4932 | S000006038 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.