🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

AK2

DescriptionAdenylate kinase 2, mitochondrial

Gene and Protein Information

Gene ID204
Uniprot Accession IDs P54819 A8K6L1 B4DHH7 B4DL64 Q16856 Q5EB54 Q5TIF7 Q8TCY2 Q8TCY3 AK 2
Ensembl ID ENSP00000346921
Symbol ADK2 ADK2
FamilyBelongs to the adenylate kinase family. AK2 subfamily.
Sequence
MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp456723AK2adenylate kinase 29598VGNC:55OMA, EggNOG
Macaque709737AK2adenylate kinase 29544Inparanoid, OMA, EggNOG
Mouse11637Ak2adenylate kinase 210090MGI:87978Inparanoid, OMA, EggNOG
Rat24184Ak2adenylate kinase 210116RGD:2077Inparanoid, OMA
Dog478145AK2adenylate kinase 29615VGNC:37746Inparanoid, OMA, EggNOG
Horse100055706AK2adenylate kinase 29796VGNC:15195Inparanoid, OMA, EggNOG
Cow280716AK2adenylate kinase 29913VGNC:25771Inparanoid, OMA, EggNOG
Opossum100026105AK2adenylate kinase 213616Inparanoid, OMA, EggNOG
Chicken428227AK2adenylate kinase 29031CGNC:2627Inparanoid, OMA, EggNOG
Anole lizard100560801ak2adenylate kinase 228377Inparanoid, OMA, EggNOG
Xenopus448011ak2adenylate kinase 28364XB-GENE-491598Inparanoid, OMA, EggNOG
Zebrafish321793ak2adenylate kinase 27955ZDB-GENE-030131-512Inparanoid, OMA, EggNOG
C. elegans176118let-754Adenylate kinase6239Inparanoid, OMA, EggNOG
Fruitfly37834Adk2Adenylate kinase 27227FBgn0283494Inparanoid, OMA, EggNOG
S.cerevisiae851812ADK1adenylate kinase ADK14932S000002634Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.