CFL1

DescriptionCofilin-1

Gene and Protein Information

Gene ID1072
Uniprot Accession IDs P23528 B3KUQ1 Q53Y87 Q9UCA2
Ensembl ID ENSP00000432660
Symbol CFL CFL cofilin HEL-S-15
FamilyBelongs to the actin-binding proteins ADF family.
Sequence
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp745772CFL1cofilin 19598VGNC:6759OMA, EggNOG
Macaque721882CFL1cofilin 19544Inparanoid, OMA, EggNOG
Mouse12631Cfl1cofilin 1, non-muscle10090MGI:101757Inparanoid, OMA, EggNOG
Rat29271Cfl1cofilin 110116RGD:69285Inparanoid, OMA, EggNOG
Dog476022CFL1cofilin 19615Inparanoid, OMA, EggNOG
Horse100057603CFL1cofilin 19796VGNC:16464Inparanoid, OMA, EggNOG
Cow534553CFL1cofilin 19913VGNC:27253Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.