🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

METTL14

DescriptionN6-adenosine-methyltransferase non-catalytic subunit

Gene and Protein Information

Gene ID57721
Uniprot Accession IDs Q9HCE5 A6NIG1 Q969V2
Ensembl ID ENSP00000373474
Symbol KIAA1627 hMETTL14
FamilyBelongs to the MT-A70-like family.
Sequence
MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp461454METTL14methyltransferase like 149598VGNC:633OMA, EggNOG
Macaque704667METTL14methyltransferase like 149544Inparanoid, OMA, EggNOG
Mouse210529Mettl14methyltransferase like 1410090MGI:2442926Inparanoid, OMA, EggNOG
Rat295428Mettl14methyltransferase like 1410116RGD:1304822Inparanoid, OMA, EggNOG
Dog487920METTL14methyltransferase like 149615VGNC:43171Inparanoid, OMA, EggNOG
Horse100072440METTL14methyltransferase like 149796VGNC:20120Inparanoid, OMA, EggNOG
Cow531382METTL14methyltransferase like 149913VGNC:31404Inparanoid, OMA, EggNOG
Pig100525761METTL14methyltransferase like 149823OMA, EggNOG
Opossum100012069METTL14methyltransferase like 1413616Inparanoid, OMA, EggNOG
Platypus100081630METTL14methyltransferase like 149258Inparanoid, OMA, EggNOG
Chicken422684METTL14methyltransferase like 149031CGNC:51803Inparanoid, OMA, EggNOG
Anole lizard100567789mettl14methyltransferase like 1428377Inparanoid, OMA, EggNOG
Xenopus493301mettl14methyltransferase like 148364XB-GENE-5813560Inparanoid, OMA, EggNOG
Zebrafish404603mettl14methyltransferase like 147955ZDB-GENE-040426-2328Inparanoid, OMA, EggNOG
Fruitfly34138CG7818CG7818 gene product from transcript CG7818-RA7227FBgn0032016Inparanoid, OMA, EggNOG
S.cerevisiae850303KAR4Kar4p4932S000000560Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.