224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Eukaryotic translation initiation factor 1A, X-chromosomal |
|---|
Gene and Protein Information
| Gene ID | 1964 |
|---|---|
| Uniprot Accession IDs | P47813 B2R5U5 Q0VGC2 Q5JPS5 Q5JPS6 eIF-1A X isoform |
| Ensembl ID | ENSP00000368927 |
| Symbol | EIF1A EIF4C EIF1A EIF4C eIF-1A eIF-4C EIF1AP1 |
| Family | Belongs to the eIF-1A family. |
| Sequence | MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 449499 | EIF1AY | eukaryotic translation initiation factor 1A, Y-linked | 9598 | OMA, EggNOG | |
| Mouse | 66235 | Eif1ax | eukaryotic translation initiation factor 1A, X-linked | 10090 | MGI:1913485 | Inparanoid, OMA, EggNOG |
| Rat | 302697 | Eif1ax | eukaryotic translation initiation factor 1A, X-linked | 10116 | RGD:1560198 | Inparanoid, OMA |
| Dog | 611715 | EIF1AX | eukaryotic translation initiation factor 1A, X-linked | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100051671 | EIF1AX | eukaryotic translation initiation factor 1A, X-linked | 9796 | Inparanoid, OMA, EggNOG | |
| Cow | 511189 | EIF1AX | eukaryotic translation initiation factor 1A, X-linked | 9913 | Inparanoid, OMA, EggNOG | |
| Opossum | 100013498 | EIF1AX | eukaryotic translation initiation factor 1A, X-linked | 13616 | OMA, EggNOG | |
| Chicken | 418606 | EIF1AY | eukaryotic translation initiation factor 1A, Y-linked | 9031 | CGNC:50803 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100557224 | eif1ax | eukaryotic translation initiation factor 1A, X-linked | 28377 | OMA, EggNOG | |
| Xenopus | 448063 | eif1ax | eukaryotic translation initiation factor 1A, X-linked | 8364 | XB-GENE-966341 | Inparanoid, OMA, EggNOG |
| Zebrafish | 322599 | eif1axb | eukaryotic translation initiation factor 1A X-linked b | 7955 | ZDB-GENE-030131-1319 | Inparanoid, OMA |
| Zebrafish | 450062 | eif1axa | eukaryotic translation initiation factor 1A X-linked a | 7955 | ZDB-GENE-041010-185 | OMA, EggNOG |
| C. elegans | 177254 | eif-1.A | Eukaryotic Initiation Factor | 6239 | Inparanoid, OMA | |
| S.cerevisiae | 855302 | TIF11 | Tif11p | 4932 | S000004873 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / translation initiation factor / Eukaryotic translation initiation factor 1A, X-chromosomal
protein / nucleic acid binding / translation initiation factor / Eukaryotic translation initiation factor 1A, X-chromosomal
DTO Classes
protein / Nucleic acid binding / RNA binding protein / Translation factor / Translation initiation factor / Eukaryotic translation initiation factor 1A, X-chromosomal
protein / Nucleic acid binding / RNA binding protein / Translation factor / Translation initiation factor / Eukaryotic translation initiation factor 1A, X-chromosomal
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.