224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Translation initiation factor IF-3, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 219402 |
|---|---|
| Uniprot Accession IDs | Q9H2K0 Q05BL8 Q5W0V0 Q86X68 IF-3(Mt) |
| Ensembl ID | ENSP00000370508 |
| Symbol | IF3mt |
| Family | Belongs to the IF-3 family. |
| Sequence | MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452504 | MTIF3 | mitochondrial translational initiation factor 3 | 9598 | VGNC:5081 | OMA, EggNOG |
| Macaque | 710571 | MTIF3 | mitochondrial translational initiation factor 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 76366 | Mtif3 | mitochondrial translational initiation factor 3 | 10090 | MGI:1923616 | Inparanoid, OMA, EggNOG |
| Rat | 684274 | Mtif3 | mitochondrial translational initiation factor 3 | 10116 | RGD:1592673 | OMA, EggNOG |
| Dog | 477328 | MTIF3 | mitochondrial translational initiation factor 3 | 9615 | VGNC:43476 | Inparanoid, OMA, EggNOG |
| Horse | 100051262 | MTIF3 | mitochondrial translational initiation factor 3 | 9796 | VGNC:20418 | Inparanoid, OMA, EggNOG |
| Cow | 509987 | MTIF3 | mitochondrial translational initiation factor 3 | 9913 | VGNC:31734 | Inparanoid, OMA, EggNOG |
| Opossum | 100025012 | MTIF3 | mitochondrial translational initiation factor 3 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100090314 | MTIF3 | mitochondrial translational initiation factor 3 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 418930 | MTIF3 | mitochondrial translational initiation factor 3 | 9031 | CGNC:12842 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100553396 | mtif3 | mitochondrial translational initiation factor 3 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 780770 | mtif3 | mitochondrial translational initiation factor 3 | 8364 | XB-GENE-877152 | Inparanoid, OMA, EggNOG |
| Zebrafish | 325802 | mtif3 | mitochondrial translational initiation factor 3 | 7955 | ZDB-GENE-060228-1 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / translation initiation factor / Translation initiation factor IF-3, mitochondrial
protein / nucleic acid binding / translation initiation factor / Translation initiation factor IF-3, mitochondrial
DTO Classes
protein / Nucleic acid binding / RNA binding protein / Translation factor / Translation initiation factor / Translation initiation factor IF-3, mitochondrial
protein / Nucleic acid binding / RNA binding protein / Translation factor / Translation initiation factor / Translation initiation factor IF-3, mitochondrial
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.