The store will not work correctly when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
DDIT3 Description DDIT3 upstream open reading frame protein
Gene and Protein Information Gene ID 1649 Uniprot Accession IDs P0DPQ6 Ensembl ID ENSP00000448665 Symbol CHOP CEBPZ CHOP10 CHOP-10 GADD153 AltDDIT3 C/EBPzeta Sequence MLKMSGWQRQSQNQSWNLRRECSRRKCIFIHHHT
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources Chimp 452017 DDIT3 DNA damage inducible transcript 3 9598 VGNC:12914 OMA, EggNOG Macaque 714901 DDIT3 DNA damage inducible transcript 3 9544 Inparanoid, OMA, EggNOG Mouse 13198 Ddit3 DNA-damage inducible transcript 3 10090 MGI:109247 Inparanoid, OMA, EggNOG Rat 29467 Ddit3 DNA-damage inducible transcript 3 10116 RGD:62391 Inparanoid, OMA, EggNOG Dog 607439 DDIT3 DNA damage inducible transcript 3 9615 VGNC:39836 Inparanoid, OMA, EggNOG Horse 100053417 DDIT3 DNA damage inducible transcript 3 9796 VGNC:17075 Inparanoid, OMA, EggNOG Cow 777788 DDIT3 DNA damage inducible transcript 3 9913 VGNC:27947 Inparanoid, OMA, EggNOG Anole lizard 100567470 ddit3 DNA damage inducible transcript 3 28377 Inparanoid, OMA Xenopus 733816 ddit3 DNA damage inducible transcript 3 8364 XB-GENE-1011286 Inparanoid, OMA, EggNOG Zebrafish 561924 ddit3 DNA-damage-inducible transcript 3 7955 ZDB-GENE-070410-90 Inparanoid, OMA
Associated Recombinant Proteins Name Specification and purity Expression system Protein label Availability View Details
Associated Antibodies
Name Specifications Species reactivity Application Availability View Details
Associated Approved Drugs Associated Active Ligands Associated Diseases Name Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Settings Agree All Decline
Shall we send you a message when we have discounts available?
Remind me later Allow
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.