224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | DNA excision repair protein ERCC-1 |
|---|
Gene and Protein Information
| Gene ID | 2067 |
|---|---|
| Uniprot Accession IDs | P07992 B2RC01 B3KRR0 Q7Z7F5 Q96S40 |
| Ensembl ID | ENSP00000013807 |
| Symbol | UV20 COFS4 RAD10 |
| Family | Belongs to the ERCC1/RAD10/SWI10 family. |
| Sequence | MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450179 | ERCC1 | ERCC excision repair 1, endonuclease non-catalytic subunit | 9598 | VGNC:2387 | Inparanoid, OMA, EggNOG |
| Macaque | 574267 | ERCC1 | ERCC excision repair 1, endonuclease non-catalytic subunit | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 13870 | Ercc1 | excision repair cross-complementing rodent repair deficiency, complementation group 1 | 10090 | MGI:95412 | Inparanoid, OMA, EggNOG |
| Rat | 292673 | Ercc1 | ERCC excision repair 1, endonuclease non-catalytic subunit | 10116 | RGD:1306992 | Inparanoid, OMA, EggNOG |
| Dog | 612282 | ERCC1 | ERCC excision repair 1, endonuclease non-catalytic subunit | 9615 | VGNC:40441 | Inparanoid, OMA, EggNOG |
| Horse | 100065660 | ERCC1 | ERCC excision repair 1, endonuclease non-catalytic subunit | 9796 | VGNC:17655 | Inparanoid, OMA, EggNOG |
| Cow | 615637 | ERCC1 | ERCC excision repair 1, endonuclease non-catalytic subunit | 9913 | VGNC:28568 | Inparanoid, OMA, EggNOG |
| Opossum | ERCC1 | ERCC excision repair 1, endonuclease non-catalytic subunit [Source:HGNC Symbol;Acc:HGNC:3433] | 13616 | Inparanoid, OMA, EggNOG | ||
| Platypus | 100087730 | ERCC1 | ERCC excision repair 1, endonuclease non-catalytic subunit | 9258 | Inparanoid, EggNOG | |
| Anole lizard | 100565865 | ercc1 | ERCC excision repair 1, endonuclease non-catalytic subunit | 28377 | OMA, EggNOG | |
| Xenopus | 100135224 | ercc1 | excision repair cross-complementation group 1 | 8364 | XB-GENE-5895462 | Inparanoid, EggNOG |
| Zebrafish | 100001425 | ercc1 | excision repair cross-complementation group 1 | 7955 | ZDB-GENE-040426-2606 | Inparanoid, EggNOG |
| C. elegans | 172867 | ercc-1 | ERCC (DNA excision repair protein) homolog | 6239 | Inparanoid, EggNOG | |
| Fruitfly | 36654 | Ercc1 | CG10215 gene product from transcript CG10215-RA | 7227 | FBgn0028434 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / DNA excision repair protein ERCC-1
protein / nucleic acid binding / nuclease / DNA excision repair protein ERCC-1
protein / nucleic acid binding / endodeoxyribonuclease / DNA excision repair protein ERCC-1
protein / nucleic acid binding / DNA binding protein / DNA excision repair protein ERCC-1
protein / nucleic acid binding / nuclease / DNA excision repair protein ERCC-1
protein / nucleic acid binding / endodeoxyribonuclease / DNA excision repair protein ERCC-1
DTO Classes
protein / Enzyme / Nuclease / Endodeoxyribonuclease / DNA excision repair protein ERCC-1
protein / Enzyme / Nuclease / Endodeoxyribonuclease / DNA excision repair protein ERCC-1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.