224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor |
|---|
Gene and Protein Information
| Gene ID | 2853 |
|---|---|
| Uniprot Accession IDs | O00270 B0M0K2 Q4VBL3 Q9NQ20 12-(S)-HETE receptor |
| Ensembl ID | ENSP00000355799 |
| Symbol | HETER HETER1 12-HETER |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MPFPNCSAPSTVVATAVGVLLGLECGLGLLGNAVALWTFLFRVRVWKPYAVYLLNLALADLLLAACLPFLAAFYLSLQAWHLGRVGCWALHFLLDLSRSVGMAFLAAVALDRYLRVVHPRLKVNLLSPQAALGVSGLVWLLMVALTCPGLLISEAAQNSTRCHSFYSRADGSFSIIWQEALSCLQFVLPFGLIVFCNAGIIRALQKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFLARVLMHIFQNLGSCRALCAVAHTSDVTGSLTYLHSVLNPVVYCFSSPTFRSSYRRVFHTLRGKGQAAEPPDFNPRDSYS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 472189 | GPR31 | G protein-coupled receptor 31 | 9598 | VGNC:2849 | OMA, EggNOG |
| Mouse | 436440 | Gpr31b | G protein-coupled receptor 31, D17Leh66b region | 10090 | MGI:1354372 | Inparanoid, OMA, EggNOG |
| Rat | 292310 | Gpr31 | G protein-coupled receptor 31 | 10116 | RGD:1305187 | Inparanoid, OMA, EggNOG |
| Dog | 484081 | GPR31 | G protein-coupled receptor 31 | 9615 | VGNC:41430 | Inparanoid, OMA, EggNOG |
| Horse | 100055116 | GPR31 | G protein-coupled receptor 31 | 9796 | VGNC:18539 | Inparanoid, OMA, EggNOG |
| Cow | 617303 | GPR31 | G protein-coupled receptor 31 | 9913 | VGNC:29582 | Inparanoid, OMA, EggNOG |
| Opossum | 100032621 | GPR31 | G protein-coupled receptor 31 | 13616 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor
protein / G-protein coupled receptor / Class A rhodopsin like / 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.