GPR32

DescriptionProbable G-protein coupled receptor 32

Gene and Protein Information

Gene ID2854
Uniprot Accession IDs O75388 Q502U7 Q6NWS5
Ensembl ID ENSP00000270590
Symbol RVDR1
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MNGVSEGTRGCSDRQPGVLTRDRSCSRKMNSSGCLSEEVGSLRPLTVVILSASIVVGVLGNGLVLWMTVFRMARTVSTVCFFHLALADFMLSLSLPIAMYYIVSRQWLLGEWACKLYITFVFLSYFASNCLLVFISVDRCISVLYPVWALNHRTVQRASWLAFGVWLLAAALCSAHLKFRTTRKWNGCTHCYLAFNSDNETAQIWIEGVVEGHIIGTIGHFLLGFLGPLAIIGTCAHLIRAKLLREGWVHANRPKRLLLVLVSAFFIFWSPFNVVLLVHLWRRVMLKEIYHPRMLLILQASFALGCVNSSLNPFLYVFVGRDFQEKFFQSLTSALARAFGEEEFLSSCPRGNAPRE
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp748574GPR32G protein-coupled receptor 329598VGNC:11123OMA, EggNOG
PigGPR32G protein-coupled receptor 32 [Source:HGNC Symbol;Acc:HGNC:4487]9823OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Probable G-protein coupled receptor 32
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Probable G-protein coupled receptor 32

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.