🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

YTHDF2

DescriptionYTH domain-containing family protein 2

Gene and Protein Information

Gene ID51441
Uniprot Accession IDs Q9Y5A9 A6NKG4 A8K966 B4E1G7 D3DPM8 Q5VSZ9 Q8TDH0 Q9BUJ5
Ensembl ID ENSP00000362918
Symbol HGRG8 CAHL HGRG8 NY-REN-2
FamilyBelongs to the YTHDF2 family.
Sequence
MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWADIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPTQGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp740305YTHDF2YTH N6-methyladenosine RNA binding protein 29598VGNC:10072OMA, EggNOG
Macaque717225YTHDF2YTH N6-methyladenosine RNA binding protein 29544Inparanoid, OMA, EggNOG
Mouse213541Ythdf2YTH domain family 210090MGI:2444233Inparanoid, OMA, EggNOG
Rat313053Ythdf2YTH N(6)-methyladenosine RNA binding protein 210116RGD:1311321Inparanoid, OMA
Dog478161YTHDF2YTH N6-methyladenosine RNA binding protein 29615VGNC:48506Inparanoid, OMA, EggNOG
Horse100070667YTHDF2YTH N6-methyladenosine RNA binding protein 29796VGNC:25116Inparanoid, OMA, EggNOG
Cow541050YTHDF2YTH N6-methyladenosine RNA binding protein 29913VGNC:37042Inparanoid, OMA, EggNOG
Pig100623159YTHDF2YTH N6-methyladenosine RNA binding protein 29823OMA, EggNOG
Opossum100021047YTHDF2YTH N6-methyladenosine RNA binding protein 213616Inparanoid, OMA, EggNOG
Anole lizard100565737ythdf2YTH N6-methyladenosine RNA binding protein 228377Inparanoid, OMA, EggNOG
Zebrafish393220ythdf2YTH N(6)-methyladenosine RNA binding protein 27955ZDB-GENE-040426-948Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.