224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Glutathione peroxidase 1 |
|---|
Gene and Protein Information
| Gene ID | 2876 |
|---|---|
| Uniprot Accession IDs | P07203 E9PAS1 Q7Z5H1 Q9BW12 GPx-1 |
| Ensembl ID | ENSP00000407375 |
| Symbol | GPXD GSHPX1 |
| Family | Belongs to the glutathione peroxidase family. |
| Sequence | MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 461015 | GPX1 | glutathione peroxidase 1 | 9598 | VGNC:53366 | OMA, EggNOG |
| Mouse | 14775 | Gpx1 | glutathione peroxidase 1 | 10090 | MGI:104887 | Inparanoid, OMA |
| Rat | 24404 | Gpx1 | glutathione peroxidase 1 | 10116 | RGD:2729 | Inparanoid, OMA |
| Dog | 442961 | GPX1 | glutathione peroxidase 1 | 9615 | VGNC:41461 | Inparanoid, OMA |
| Opossum | GPX1 | glutathione peroxidase 1 [Source:HGNC Symbol;Acc:HGNC:4553] | 13616 | Inparanoid, OMA |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.