224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Mitochondrial import receptor subunit TOM40 homolog |
|---|
Gene and Protein Information
| Gene ID | 10452 |
|---|---|
| Uniprot Accession IDs | O96008 A0A024R0P9 Q86VW4 Q8WY09 Q8WY10 Q8WY11 Q9BR95 |
| Ensembl ID | ENSP00000410339 |
| Symbol | C19orf1 PEREC1 TOM40 TOM40 PEREC1 C19orf1 PER-EC1 D19S1177E |
| Family | Belongs to the Tom40 family. |
| Sequence | MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 713297 | TOMM40 | translocase of outer mitochondrial membrane 40 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 53333 | Tomm40 | translocase of outer mitochondrial membrane 40 | 10090 | MGI:1858259 | Inparanoid, OMA, EggNOG |
| Rat | 308416 | Tomm40 | translocase of outer mitochondrial membrane 40 | 10116 | RGD:1303022 | Inparanoid, OMA, EggNOG |
| Dog | 611055 | TOMM40 | translocase of outer mitochondrial membrane 40 | 9615 | VGNC:49033 | Inparanoid, OMA |
| Horse | 100146715 | TOMM40 | translocase of outer mitochondrial membrane 40 | 9796 | VGNC:50512 | Inparanoid, OMA |
| Cow | 510219 | TOMM40 | translocase of outer mitochondrial membrane 40 | 9913 | VGNC:49148 | Inparanoid, OMA |
| Opossum | 100016132 | TOMM40 | translocase of outer mitochondrial membrane 40 | 13616 | Inparanoid, OMA | |
| Anole lizard | 100563052 | tomm40 | translocase of outer mitochondrial membrane 40 | 28377 | Inparanoid, OMA | |
| Xenopus | 394730 | tomm40 | translocase of outer mitochondrial membrane 40 homolog | 8364 | XB-GENE-995150 | Inparanoid, OMA |
| Zebrafish | 405895 | tomm40l | translocase of outer mitochondrial membrane 40 homolog, like | 7955 | ZDB-GENE-040426-2319 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.