TIMM50

DescriptionMitochondrial import inner membrane translocase subunit TIM50

Gene and Protein Information

Gene ID92609
Uniprot Accession IDs Q3ZCQ8 Q330K1 Q6QA00 Q96FJ5 Q96GY2 Q9H370
Ensembl ID ENSP00000445806
Symbol TIM50 MGCA9 TIM50 TIM50L
FamilyBelongs to the TIM50 family.
Sequence
MAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQAAEIGSRGSTKAQGPQQQPGSEGPSYAKKVALWLAGLLGAGGTVSVVYIFGNNPVDENGAKIPDEFDNDPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLQEPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVRTVLEHYALEDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp456026TIMM50translocase of inner mitochondrial membrane 509598VGNC:8335OMA, EggNOG
Macaque697583TIMM50translocase of inner mitochondrial membrane 509544OMA, EggNOG
Mouse66525Timm50translocase of inner mitochondrial membrane 5010090MGI:1913775Inparanoid, OMA, EggNOG
Rat687295Timm50translocase of inner mitochondrial membrane 5010116RGD:1587684OMA, EggNOG
Dog476461TIMM50translocase of inner mitochondrial membrane 509615VGNC:49032Inparanoid, OMA, EggNOG
Horse100067604TIMM50translocase of inner mitochondrial membrane 509796VGNC:50508Inparanoid, OMA, EggNOG
Cow505489TIMM50translocase of inner mitochondrial membrane 509913VGNC:49147Inparanoid, OMA, EggNOG
Pig100623818TIMM50translocase of inner mitochondrial membrane 509823OMA, EggNOG
Opossum100014514TIMM50translocase of inner mitochondrial membrane 5013616Inparanoid, OMA, EggNOG
Anole lizard100568074timm50translocase of inner mitochondrial membrane 5028377Inparanoid, EggNOG
Xenopus100145004timm50translocase of inner mitochondrial membrane 50 homolog8364XB-GENE-963112Inparanoid, OMA, EggNOG
Zebrafish393638timm50translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae)7955ZDB-GENE-040426-1618Inparanoid, OMA, EggNOG
C. elegans179481scpl-4Mitochondrial import inner membrane translocase subunit TIM506239Inparanoid, EggNOG
S.cerevisiae856042TIM50protein translocase subunit TIM504932S000005984Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.