🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

TMPRSS2

DescriptionTransmembrane protease serine 2

Gene and Protein Information

Gene ID7113
Uniprot Accession IDs O15393 A8K6Z8 B2R8E5 B7Z459 D3DSJ2 F8WES1 Q6GTK7 Q9BXX1
Ensembl ID ENSP00000381588
Symbol PRSS10 PP9284 PRSS10
FamilyBelongs to the peptidase S1 family.
Sequence
MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp474007TMPRSS2transmembrane serine protease 29598VGNC:3729OMA, EggNOG
Macaque715138TMPRSS2transmembrane protease, serine 29544OMA, EggNOG
Mouse50528Tmprss2transmembrane protease, serine 210090MGI:1354381Inparanoid, OMA, EggNOG
Rat156435Tmprss2transmembrane serine protease 210116RGD:620766Inparanoid, OMA, EggNOG
Dog487770TMPRSS2transmembrane serine protease 29615VGNC:53045Inparanoid, OMA, EggNOG
Horse100058498TMPRSS2transmembrane serine protease 29796VGNC:24341Inparanoid, OMA, EggNOG
Cow511037TMPRSS2transmembrane serine protease 29913VGNC:36140Inparanoid, OMA, EggNOG
Opossum100016391TMPRSS2transmembrane protease, serine 213616Inparanoid, OMA, EggNOG
Chicken418528TMPRSS2transmembrane protease, serine 29031CGNC:12069Inparanoid, OMA
Anole lizard100552320tmprss2transmembrane protease, serine 228377Inparanoid, OMA
Zebrafish494080tmprss2transmembrane serine protease 27955ZDB-GENE-041212-48Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.