🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

TOMM20

DescriptionMitochondrial import receptor subunit TOM20 homolog

Gene and Protein Information

Gene ID9804
Uniprot Accession IDs Q15388 A8K195 Q498B3 Q6IBT4
Ensembl ID ENSP00000355566
Symbol KIAA0016 MAS20 MOM19 TOM20
FamilyBelongs to the Tom20 family.
Sequence
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp457833TOMM20translocase of outer mitochondrial membrane 209598VGNC:8554OMA, EggNOG
Mouse67952Tomm20translocase of outer mitochondrial membrane 2010090MGI:1915202Inparanoid, OMA, EggNOG
Rat266601Tomm20translocase of outer mitochondrial membrane 2010116RGD:708467Inparanoid, OMA, EggNOG
Dog100682999TOMM20translocase of outer mitochondrial membrane 209615VGNC:49025Inparanoid, OMA, EggNOG
Horse100058806TOMM20translocase of outer mitochondrial membrane 209796VGNC:49074Inparanoid, OMA, EggNOG
Cow781575TOMM20translocase of outer mitochondrial membrane 209913Inparanoid, OMA, EggNOG
Pig100152814TOMM20translocase of outer mitochondrial membrane 209823Inparanoid, OMA, EggNOG
Opossum100021351TOMM20translocase of outer mitochondrial membrane 2013616Inparanoid, OMA, EggNOG
Anole lizardTOMM20Ltranslocase of outer mitochondrial membrane 20 like [Source:HGNC Symbol;Acc:HGNC:33752]28377Inparanoid, OMA
Xenopus448537tomm20translocase of outer mitochondrial membrane 20 homolog8364XB-GENE-972815Inparanoid, OMA, EggNOG
Zebrafish436971tomm20btranslocase of outer mitochondrial membrane 20b7955ZDB-GENE-040718-451Inparanoid, OMA
C. elegans179691tomm-20Mitochondrial import receptor subunit TOM20 homolog6239Inparanoid, OMA
Fruitfly40189Tom20Translocase of outer membrane 207227FBgn0036928Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.